Ver en grande 
ACACB monoclonal antibody (M02A), clone 3E8 - 200 uL
AB-H00000032-M02A-200 uL
Producto nuevo
ACACB monoclonal antibody (M02A), clone 3E8
Al comprar este producto puede obtener hasta 30 puntos de fidelidad. Su cesta totalizará 30 puntos de fidelidad que se puede(n) transformar en un cupón de descuento de 6.00EUR.
Ficha de datos
| Size | 200 uL |
| Shipping Conditions | ACACB |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | acetyl-Coenzyme A carboxylase beta |
| Gene Alias | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Gene Description | acetyl-Coenzyme A carboxylase beta |
| Species Reactivity Cross | ELISA,WB-Re |
| Target Species | Human |
| Applications | ELISA,WB-Re |
| Detection Range | 200 uL |
| Specificity | ELISA,WB-Re |
| Function | Human |
| Application Key | ELISA,WB-Re |
| Inmunogen Prot. Seq | IWGKMTDSKPITKSKSEANLIPSQEPFPASDNSGETPQRNGEGHTLPKTPSQAEPASHKGPKDAGRRRNSLPPSHQKPPRNPLSSSDAAPSPELQANGT |
| Quality Control | ANTIBODY Reactive Against Recombinant Protein. |
| Type Clonality | Antibody |
| Tissue | Human |
| Raised in host species | Antibody Reactive Against Recombinant Protein. |
| Antiges species target | Human |
| Storage Buffer | Human |
| Gene id | 32 |
| CAS Number | ACACB (NP_001084, 22 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Solubility | In ascites fluid |
Más información
Mouse monoclonal antibody raised against a partial recombinant ACACB.