AB-H00000027-M04-100 ug
Producto nuevo
Este producto ya no esta disponible
Fecha disponibilidad
Al comprar este producto puede obtener hasta 30 puntos de fidelidad. Su cesta totalizará 30 puntos de fidelidad que se puede(n) transformar en un cupón de descuento de 6.00EUR.
Size | 100 ug |
Shipping Conditions | ABL2 |
Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
Gene Name | v-abl Abelson murine leukemia viral oncogene homolog 2 (arg, Abelson-related gene) |
Gene Alias | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
Gene Description | v-abl Abelson murine leukemia viral oncogene homolog 2 (arg, Abelson-related gene) |
Species Reactivity Cross | WB-Ce,S-ELISA,ELISA,WB-Re |
Target Species | Human |
Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
Detection Range | 100 ug |
Specificity | WB-Ce,S-ELISA,ELISA,WB-Re |
Function | Human |
Application Key | WB-Ce,S-ELISA,ELISA,WB-Re |
Inmunogen Prot. Seq | KKTLGLRAGKPTASDDTSKPFPRSNSTSSMSSGLPEQDRMAMTLPRNCQRSKLQLERTVSTSSQPEENVDRANDMLPKKSEESAAPSRERPKAKLLPRGA |
Quality Control | ANTIBODY Reactive Against Recombinant Protein. |
Type Clonality | Antibody |
Tissue | Human |
Raised in host species | Antibody Reactive Against Recombinant Protein. |
Antiges species target | Human |
Storage Buffer | Human |
Gene id | 27 |
CAS Number | ABL2 (AAH65912, 743 a.a. ~ 842 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Solubility | In 1x PBS, pH 7.4 |