AB-H00000024-A01-50 uL
Producto nuevo
Este producto ya no esta disponible
Fecha disponibilidad
Al comprar este producto puede obtener hasta 21 puntos de fidelidad. Su cesta totalizará 21 puntos de fidelidad que se puede(n) transformar en un cupón de descuento de 4.20EUR.
Size | 50 uL |
Shipping Conditions | ABCA4 |
Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
Gene Name | ATP-binding cassette, sub-family A (ABC1), member 4 |
Gene Alias | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
Gene Description | ATP-binding cassette, sub-family A (ABC1), member 4 |
Species Reactivity Cross | WB-Ce,ELISA,WB-Re |
Target Species | Human |
Applications | WB-Ce,ELISA,WB-Re |
Detection Range | 50 uL |
Specificity | WB-Ce,ELISA,WB-Re |
Function | Human |
Application Key | WB-Ce,ELISA,WB-Re |
Inmunogen Prot. Seq | PKDDLLPDLNPVEQFFQGNFPGSVQRERHYNMLQFQVSSSSLARIFQLLLSHKDSLLIEEYSVTQTTLDQVFVNFAKQQTESHDLPLHPRAAGASRQAQD |
Quality Control | ANTIBODY Reactive Against Recombinant Protein. |
Type Clonality | Antibody |
Tissue | Human |
Raised in host species | Antibody Reactive Against Recombinant Protein. |
Antiges species target | Human |
Storage Buffer | Human |
Gene id | 24 |
CAS Number | ABCA4 (NP_000341, 2174 a.a. ~ 2273 a.a) partial recombinant protein with GST tag. |
Solubility | 50 % glycerol |