Ver en grande 
NAT2 MaxPab rabbit polyclonal antibody (D01) - 100 uL
AB-H00000010-D01-100 uL
Producto nuevo
NAT2 MaxPab rabbit polyclonal antibody (D01)
Al comprar este producto puede obtener hasta 31 puntos de fidelidad. Su cesta totalizará 31 puntos de fidelidad que se puede(n) transformar en un cupón de descuento de 6.20EUR.
Ficha de datos
| Size | 100 uL |
| Shipping Conditions | NAT2 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | N-acetyltransferase 2 (arylamine N-acetyltransferase) |
| Gene Alias | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Gene Description | N-acetyltransferase 2 (arylamine N-acetyltransferase) |
| Species Reactivity Cross | WB-Tr,IP |
| Target Species | Human |
| Applications | WB-Tr,Det Ab,IP |
| Detection Range | 100 uL |
| Specificity | WB-Tr,IP |
| Function | Human |
| Application Key | WB-Tr,IP |
| Inmunogen Prot. Seq | MDIEAYFERIGYKNSRNKLDLETLTDILEHQIRAVPFENLNMHCGQAMELGLEAIFDHIVRRNRGGWCLQVNQLLYWALTTIGFQTTMLGGYFYIPPVNKYSTGMVHLLLQVTIDGRNYIVDAGSGSSSQMWQPLELISGKDQPQVPCIFCLTEERGIWYLDQIRREQYITNKEFLNSHLLPKKKHQKIYLFTLEPQTIEDFESMNTYLQTSPTSSFITTSFCSLQTPEGVYCLVGFILTYRKFNYKDNTDLVEF |
| Quality Control | ANTIBODY reactive against mammalian transfected lysate. |
| Type Clonality | Antibody |
| Tissue | Human |
| Raised in host species | Antibody reactive against mammalian transfected lysate. |
| Antiges species target | Human |
| Storage Buffer | Human |
| Gene id | 10 |
| CAS Number | NAT2 (AAH15878.1, 1 a.a. ~ 290 a.a) full-length human protein. |
| Solubility | No additive |
Más información
Rabbit polyclonal antibody raised against a full-length human NAT2 protein.