AB-H00000010-B01P-50 ug
Producto nuevo
Este producto ya no esta disponible
Fecha disponibilidad
Al comprar este producto puede obtener hasta 30 puntos de fidelidad. Su cesta totalizará 30 puntos de fidelidad que se puede(n) transformar en un cupón de descuento de 6.00EUR.
Size | 50 ug |
Shipping Conditions | NAT2 |
Storage Conditions | AAC2|PNAT |
Gene Name | N-acetyltransferase 2 (arylamine N-acetyltransferase) |
Gene Alias | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
Gene Description | N-acetyltransferase 2 (arylamine N-acetyltransferase) |
Species Reactivity Cross | WB-Ti,WB-Tr |
Target Species | Human |
Applications | WB-Ti,WB-Tr,Det Ab |
Detection Range | 50 ug |
Specificity | WB-Ti,WB-Tr |
Function | Human |
Application Key | WB-Ti,WB-Tr |
Inmunogen Prot. Seq | MDIEAYFERIGYKNSRNKLDLETLTDILEHQIRAVPFENLNMHCGQAMELGLEAIFDHIVRRNRGGWCLQVNQLLYWALTTIGFQTTMLGGYFYIPPVNKYSTGMVHLLLQVTIDGRNYIVDAGSGSSSQMWQPLELISGKDQPQVPCIFCLTEERGIWYLDQIRREQYITNKEFLNSHLLPKKKHQKIYLFTLEPQTIEDFESMNTYLQTSPTSSFITTSFCSLQTPEGVYCLVGFILTYRKFNYKDNTDLVEF |
Quality Control | ANTIBODY reactive against mammalian transfected lysate. |
Type Clonality | Antibody |
Tissue | Human |
Raised in host species | Antibody reactive against mammalian transfected lysate. |
Antiges species target | Human |
Storage Buffer | Human |
Gene id | 10 |
CAS Number | NAT2 (AAH15878.1, 1 a.a. ~ 290 a.a) full-length human protein. |
Solubility | In 1x PBS, pH 7.4 |