AB-H00000002-B01-50 uL
Producto nuevo
Este producto ya no esta disponible
Fecha disponibilidad
Al comprar este producto puede obtener hasta 29 puntos de fidelidad. Su cesta totalizará 29 puntos de fidelidad que se puede(n) transformar en un cupón de descuento de 5.80EUR.
Size | 50 uL |
Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
Gene Name | A2M |
Gene Alias | CPAMD5|DKFZp779B086|FWP007|S863-7 |
Gene Description | alpha-2-macroglobulin |
Species Reactivity Cross | Human |
Target Species | Human |
Applications | WB-Ti,WB-Tr,Det Ab |
Detection Range | 50 uL |
Application Key | WB-Ti,WB-Tr |
Inmunogen Prot. Seq | MGKNKLLHPSLVLLLLVLLPTDASVSGKPQYMVLVPSLLHTETTEKGCVLLSYLNETVTVSASLESVRGNRSLFTDLEAENDVLHCVAFAVPKSSSNEEVMFLTVQVKGPTQEFKKRTTVMVKNEDSLVFVQTDKSIYKPGQTVKFRVVSMDENFHPLNELIPLVYIQDPKGNRIAQWQSFQLEGGLKQFSFPLSSEPFQGSYKVVVQKKSGGRTEHPFTVEEFVLPKFEVQVTVPKIITILEEEMNVSVCGLYT |
Quality Control | ANTIBODY reactive against mammalian transfected lysate. |
Type Clonality | Antibody |
Raised in host species | Mouse |
Antiges species target | Human |
Storage Buffer | No additive |
Gene id | 2 |