Ver en grande 
A2M MaxPab mouse polyclonal antibody (B01) - 50 uL
AB-H00000002-B01-50 uL
Producto nuevo
A2M MaxPab mouse polyclonal antibody (B01)
Al comprar este producto puede obtener hasta 30 puntos de fidelidad. Su cesta totalizará 30 puntos de fidelidad que se puede(n) transformar en un cupón de descuento de 6.00EUR.
Ficha de datos
| Size | 50 uL |
| Shipping Conditions | A2M |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | alpha-2-macroglobulin |
| Gene Alias | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Gene Description | alpha-2-macroglobulin |
| Species Reactivity Cross | WB-Ti,WB-Tr |
| Target Species | Human |
| Applications | WB-Ti,WB-Tr,Det Ab |
| Detection Range | 50 uL |
| Specificity | WB-Ti,WB-Tr |
| Function | Human |
| Application Key | WB-Ti,WB-Tr |
| Inmunogen Prot. Seq | MGKNKLLHPSLVLLLLVLLPTDASVSGKPQYMVLVPSLLHTETTEKGCVLLSYLNETVTVSASLESVRGNRSLFTDLEAENDVLHCVAFAVPKSSSNEEVMFLTVQVKGPTQEFKKRTTVMVKNEDSLVFVQTDKSIYKPGQTVKFRVVSMDENFHPLNELIPLVYIQDPKGNRIAQWQSFQLEGGLKQFSFPLSSEPFQGSYKVVVQKKSGGRTEHPFTVEEFVLPKFEVQVTVPKIITILEEEMNVSVCGLYT |
| Quality Control | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
| Type Clonality | Antibody |
| Tissue | Human |
| Raised in host species | Antibody reactive against mammalian transfected lysate. |
| Antiges species target | Human |
| Storage Buffer | Human |
| Gene id | 2 |
| CAS Number | A2M (AAH40071.1, 1 a.a. ~ 1474 a.a) full-length human protein. |
| Solubility | No additive |
Más información
Mouse polyclonal antibody raised against a full-length human A2M protein.